PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.004G231700.1.p
Common NameSb04g027540, SORBIDRAFT_04g027540
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 331aa    MW: 36591.3 Da    PI: 6.0965
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.004G231700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.43.7e-191461148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+WT+eEd++l ++++++G g+W++ +r  g++R++k+c++rw +yl
  Sobic.004G231700.1.p 14 KGPWTPEEDQKLMEYIQKHGHGSWRALPRLAGLNRCGKSCRLRWTNYL 61
                          79********************************************97 PP

2Myb_DNA-binding57.92.3e-1867112148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           rg++T+eE++ +++++  lG++ W++Ia++++ gRt++++k++w+++l
  Sobic.004G231700.1.p  67 RGKFTQEEEQTILQLHSVLGNK-WSAIAKHLP-GRTDNEIKNFWNTHL 112
                           89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.1E-27564IPR009057Homeodomain-like
PROSITE profilePS5129418.992961IPR017930Myb domain
SuperFamilySSF466892.9E-3311108IPR009057Homeodomain-like
SMARTSM007172.5E-151363IPR001005SANT/Myb domain
PfamPF002497.0E-181461IPR001005SANT/Myb domain
CDDcd001673.22E-121661No hitNo description
PROSITE profilePS5129428.19262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.5E-2965117IPR009057Homeodomain-like
SMARTSM007171.1E-1766114IPR001005SANT/Myb domain
PfamPF002493.2E-1767112IPR001005SANT/Myb domain
CDDcd001671.62E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MGRSPCCDEN GLKKGPWTPE EDQKLMEYIQ KHGHGSWRAL PRLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF TQEEEQTILQ LHSVLGNKWS AIAKHLPGRT DNEIKNFWNT HLKKKLIQMG  120
FDPMTHRPRT DFFAALPQLI ALANLRQLVE QRPWDDHTAR IQVEAVQAAK LQCLQNLLQS  180
AASIATSPSS SSINTNTIPS DLEQIGLLSP PQMSSLSTLP SPSFLESISG QDIAAAGQLP  240
DIQIPSSFFE QQPTSNDANQ HSDFTPKSSV EGENGTPKTL LLSENSLPPL TDFPISNLGD  300
ACGASSCDGS SIPFPSWPEL FDEQFICEFV *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C4e-32121162105C-Myb DNA-Binding Domain
1msf_C4e-32121162105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00180DAPTransfer from AT1G34670Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0700450.0BT070045.1 Zea mays full-length cDNA clone ZM_BFb0376N06 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002452535.10.0hypothetical protein SORBIDRAFT_04g027540
SwissprotQ8GWP02e-73MYB39_ARATH; Transcription factor MYB39
TrEMBLC5XYD80.0C5XYD8_SORBI; Putative uncharacterized protein Sb04g027540
STRINGSb04g027540.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP112637132
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.11e-102myb domain protein 93